Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bcl11a Peptide - N-terminal region

Bcl11a Peptide - N-terminal region

Product Specifications

UniProt

D3ZSY3

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Bcl11a Rabbit Polyclonal Antibody (orb577177) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001178612

Preservative

Lyophilized powder

AA Sequence

KREFSPEPLEAILTDDEPDHGPLGAPEGDHDLLTCGQCQMNFPLGDILIF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mini Capsule Filter, PES,0.1μm, Gen Purpose, Not Sterile,300cm2,1/4"NPT-M, Luer-Lock, Bag label
CNKPS0010GN034NMLL0 1 Piece/Case:1 Piece/ PACKS:1 PACKS/CASE

Mini Capsule Filter, PES,0.1μm, Gen Purpose, Not Sterile,300cm2,1/4"NPT-M, Luer-Lock, Bag label

Sign In for Pricing
View Details
Recombinant Haemophilus influenzae UPF0149 protein HI_0817 (HI_0817)
MBS1166076-01 0.02 mg (E-Coli)

Recombinant Haemophilus influenzae UPF0149 protein HI_0817 (HI_0817)

Sign In for Pricing
View Details
Recombinant Haemophilus influenzae UPF0149 protein HI_0817 (HI_0817)
MBS1166076-02 0.1 mg (E-Coli)

Recombinant Haemophilus influenzae UPF0149 protein HI_0817 (HI_0817)

Sign In for Pricing
View Details
Recombinant Haemophilus influenzae UPF0149 protein HI_0817 (HI_0817)
MBS1166076-03 0.02 mg (Yeast)

Recombinant Haemophilus influenzae UPF0149 protein HI_0817 (HI_0817)

Sign In for Pricing
View Details
Recombinant Haemophilus influenzae UPF0149 protein HI_0817 (HI_0817)
MBS1166076-04 0.1 mg (Yeast)

Recombinant Haemophilus influenzae UPF0149 protein HI_0817 (HI_0817)

Sign In for Pricing
View Details
Recombinant Haemophilus influenzae UPF0149 protein HI_0817 (HI_0817)
MBS1166076-05 0.02 mg (Baculovirus)

Recombinant Haemophilus influenzae UPF0149 protein HI_0817 (HI_0817)

Sign In for Pricing
View Details