Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bcl11a Peptide - N-terminal region

Bcl11a Peptide - N-terminal region

Product Specifications

UniProt

D3ZSY3

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Bcl11a Rabbit Polyclonal Antibody (orb577177) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001178612

Preservative

Lyophilized powder

AA Sequence

KREFSPEPLEAILTDDEPDHGPLGAPEGDHDLLTCGQCQMNFPLGDILIF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mum1 ORF Vector (Rat) (pORF)
31150016 1.0 µg DNA

Mum1 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
IL 7 receptor alpha Rabbit Monoclonal Antibody
E49Y8374 100 µL

IL 7 receptor alpha Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Human MORC1 Pre-designed siRNA Set A
SI009718A 1 Each

Human MORC1 Pre-designed siRNA Set A

Sign In for Pricing
View Details
NODAL (Nodal Homolog (mouse), MGC138230, OTTHUMP00000019754) (MaxLight 490)
207817-ML490 100 µL

NODAL (Nodal Homolog (mouse), MGC138230, OTTHUMP00000019754) (MaxLight 490)

Sign In for Pricing
View Details
RGS13 (Regulator of G-Protein Signaling 13, MGC17173) (FITC)
251089-FITC 100 µL

RGS13 (Regulator of G-Protein Signaling 13, MGC17173) (FITC)

Sign In for Pricing
View Details
Recombinant Conus imperialis Conotoxin Im11.2
MBS1074489-01 0.02 mg (E-Coli)

Recombinant Conus imperialis Conotoxin Im11.2

Sign In for Pricing
View Details