Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Grhl2 Peptide - N-terminal region

Grhl2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

RGD1561191

UniProt

B5DEI9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Grhl2 Rabbit Polyclonal Antibody (orb577217) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001127999

Preservative

Lyophilized powder

AA Sequence

MPSDPPFNTRRAYTSEDEAWKSYLENPLTAATKAMMSINGDEDSAAALGL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DPY19L2, CT (Protein dpy-19 homolog 2, Dpy-19-like protein 2) (Biotin)
MBS6293424-01 0.2 mL

DPY19L2, CT (Protein dpy-19 homolog 2, Dpy-19-like protein 2) (Biotin)

Sign In for Pricing
View Details
DPY19L2, CT (Protein dpy-19 homolog 2, Dpy-19-like protein 2) (Biotin)
MBS6293424-02 5x 0.2 mL

DPY19L2, CT (Protein dpy-19 homolog 2, Dpy-19-like protein 2) (Biotin)

Sign In for Pricing
View Details
IL-33 (E2T5L) Rabbit Monoclonal Antibody
CST 88513T 20 µL

IL-33 (E2T5L) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
APC-C750 Anti-Human CD19
19AC750-100T 100 Tests

APC-C750 Anti-Human CD19

Sign In for Pricing
View Details
Ailanthone
BA9175-25 25 mg

Ailanthone

Sign In for Pricing
View Details
Anti-HHAT Antibody Picoband®
A06582-1 100 µg/Vial

Anti-HHAT Antibody Picoband®

Sign In for Pricing
View Details