Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STK11 Peptide - middle region

STK11 Peptide - middle region

Product Specifications

Product Name Alternative

LKB1, PJS, hLKB1

UniProt

Q15831

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_000446

Preservative

Lyophilized powder

AA Sequence

KDIKPGNLLLTTGGTLKISDLGVAEALHPFAADDTCRTSQGSPAFQPPEI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C9orf40 (NM_017998) Human Over-expression Lysate
LH10509V 100 µg

C9orf40 (NM_017998) Human Over-expression Lysate

Sign In for Pricing
View Details
DYNC1H1 (Cytoplasmic Dynein 1 Heavy Chain 1, p22, DHC1, DNCL, DYHC, HL-3, DHC1a, DNCH1, DNECL, Dnchc1, SMALED1) (FITC)
MBS6414817-01 0.1 mL

DYNC1H1 (Cytoplasmic Dynein 1 Heavy Chain 1, p22, DHC1, DNCL, DYHC, HL-3, DHC1a, DNCH1, DNECL, Dnchc1, SMALED1) (FITC)

Sign In for Pricing
View Details
DYNC1H1 (Cytoplasmic Dynein 1 Heavy Chain 1, p22, DHC1, DNCL, DYHC, HL-3, DHC1a, DNCH1, DNECL, Dnchc1, SMALED1) (FITC)
MBS6414817-02 5x 0.1 mL

DYNC1H1 (Cytoplasmic Dynein 1 Heavy Chain 1, p22, DHC1, DNCL, DYHC, HL-3, DHC1a, DNCH1, DNECL, Dnchc1, SMALED1) (FITC)

Sign In for Pricing
View Details
STK32A (Serine/Threonine-protein Kinase 32A, MGC22688, YANK1) (FITC)
MBS6149944-01 0.1 mL

STK32A (Serine/Threonine-protein Kinase 32A, MGC22688, YANK1) (FITC)

Sign In for Pricing
View Details
STK32A (Serine/Threonine-protein Kinase 32A, MGC22688, YANK1) (FITC)
MBS6149944-02 5x 0.1 mL

STK32A (Serine/Threonine-protein Kinase 32A, MGC22688, YANK1) (FITC)

Sign In for Pricing
View Details
Btk sgRNA CRISPR Lentivector (Rat) (Target 1)
K6738102 1.0 µg DNA

Btk sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details