What is the catalog number for PPAP2A Peptide - N-terminal region?

The catalog number for PPAP2A Peptide - N-terminal region is orb2006893.

What sizes are available for PPAP2A Peptide - N-terminal region?

PPAP2A Peptide - N-terminal region is available in the following size(s): 100 µg.

Is PPAP2A Peptide - N-terminal region in stock?

PPAP2A Peptide - N-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

PPAP2A Peptide - N-terminal region

Product Specifications

Product Name Alternative

LLP1a, LPP1, PAP-2a, PAP2, PAP2a2, PAP2alpha2, PAPalpha1

UniProt

O14494

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_003702

Preservative

Lyophilized powder

AA Sequence

FDKTRLPYVALDVLCVLLAGLPFAILTSRHTPFQRGVFCNDESIKYPYKE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PV233223 500 ng

Speer4b Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing

View Details

CVD03480-01 50 mg

2,2-Dioxo-1H,3H,4H-2λ6-pyrrolo[2,1-c][1,4]thiazine-8-carboxylic acid

Sign In for Pricing

View Details

CVD03480-02 0.5 g

2,2-Dioxo-1H,3H,4H-2λ6-pyrrolo[2,1-c][1,4]thiazine-8-carboxylic acid

Sign In for Pricing

View Details

sc-9980 200 µg/mL

EIF2Bγ (P-5)

Sign In for Pricing

View Details

513802 100 µg

RPS13 discontinued

Sign In for Pricing

View Details

23-129 100 µL

RAC1 Antibody

Sign In for Pricing

View Details