Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPAP2A Peptide - N-terminal region

PPAP2A Peptide - N-terminal region

Product Specifications

Product Name Alternative

LLP1a, LPP1, PAP-2a, PAP2, PAP2a2, PAP2alpha2, PAPalpha1

UniProt

O14494

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_003702

Preservative

Lyophilized powder

AA Sequence

FDKTRLPYVALDVLCVLLAGLPFAILTSRHTPFQRGVFCNDESIKYPYKE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PSAP (NM_001042465) Human Tagged ORF Clone Lentiviral Particle
RC212986L4V 200 µL

PSAP (NM_001042465) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Human Peroxisome Proliferator Activated Receptor Gamma Coactivator 1 Alpha ELISA kit
GTR10405387 96 Well

Human Peroxisome Proliferator Activated Receptor Gamma Coactivator 1 Alpha ELISA kit

Sign In for Pricing
View Details
ERp57 (MaP.ERp57) Alexa Fluor® 594
sc-23886 AF594 200 µg/mL

ERp57 (MaP.ERp57) Alexa Fluor® 594

Sign In for Pricing
View Details
Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) RMP1 Polyclonal Antibody
MBS7190483 Inquire

Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) RMP1 Polyclonal Antibody

Sign In for Pricing
View Details
CD98 (SLC3A2) (NM_001012664) Human Tagged Lenti ORF Clone
RC216693L2 10 µg

CD98 (SLC3A2) (NM_001012664) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
GLI1 Rabbit pAb
E45R28175N-100 100 µL

GLI1 Rabbit pAb

Sign In for Pricing
View Details