Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hdac4 Peptide - C-terminal region

Hdac4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

4932408F19Rik, AI047285

UniProt

Q6NZM9

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Hdac4 Rabbit Polyclonal Antibody (orb330319) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

ChIP, WB

NCBI Accession Number

NP_997108

Preservative

Lyophilized powder

AA Sequence

SSTVGHSLIEAQKCEKEEAETVTAMASLSVGVKPAEKRSEEEPMEEEPPL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat anti Rat IgA (Fc specific)
MBS571840-01 10 mg

Goat anti Rat IgA (Fc specific)

Sign In for Pricing
View Details
Goat anti Rat IgA (Fc specific)
MBS571840-02 5x 10 mg

Goat anti Rat IgA (Fc specific)

Sign In for Pricing
View Details
TRBD1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV787981 1.0 µg DNA

TRBD1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
RPLP0P11 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV781591 1.0 µg DNA

RPLP0P11 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
Recombinant Lactobacillus helveticus Peptide chain release factor 3 (prfC), partial
MBS1043114 Inquire

Recombinant Lactobacillus helveticus Peptide chain release factor 3 (prfC), partial

Sign In for Pricing
View Details
GSTT4 Rabbit Polyclonal Antibody (BF405)
orb2500752 100 µL

GSTT4 Rabbit Polyclonal Antibody (BF405)

Sign In for Pricing
View Details