Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hdac4 Peptide - C-terminal region

Hdac4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

4932408F19Rik, AI047285

UniProt

Q6NZM9

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Hdac4 Rabbit Polyclonal Antibody (orb330319) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

ChIP, WB

NCBI Accession Number

NP_997108

Preservative

Lyophilized powder

AA Sequence

SSTVGHSLIEAQKCEKEEAETVTAMASLSVGVKPAEKRSEEEPMEEEPPL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CNOT10 Antibody / CCR4-NOT transcription complex subunit 10
orb2635073-01 20 µg

CNOT10 Antibody / CCR4-NOT transcription complex subunit 10

Sign In for Pricing
View Details
CNOT10 Antibody / CCR4-NOT transcription complex subunit 10
orb2635073-02 100 µg

CNOT10 Antibody / CCR4-NOT transcription complex subunit 10

Sign In for Pricing
View Details
N4BP2L1 Antibody - N-terminal region
MBS3218661-01 0.1 mL

N4BP2L1 Antibody - N-terminal region

Sign In for Pricing
View Details
N4BP2L1 Antibody - N-terminal region
MBS3218661-02 5x 0.1 mL

N4BP2L1 Antibody - N-terminal region

Sign In for Pricing
View Details
Polyclonal BNIP2 Antibody - C-terminal region
APR01491G 0.05mg

Polyclonal BNIP2 Antibody - C-terminal region

Sign In for Pricing
View Details
TCFL5 Recombinant Protein Antigen
NBP2-49174PEP 0.1 mL

TCFL5 Recombinant Protein Antigen

Sign In for Pricing
View Details