Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cdh7 Peptide - N-terminal region

Cdh7 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Cad7

UniProt

Q5DWV2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Cdh7 Rabbit Polyclonal Antibody (orb579787) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001012755

Preservative

Lyophilized powder

AA Sequence

WNQFFVLEEYMGSDPLYVGKLHSDVDKGDGFIKYILSGEGASSIFIIDEN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CYP8B1 Antibody (C-term)
orb1427744-01 50 µL

CYP8B1 Antibody (C-term)

Sign In for Pricing
View Details
CYP8B1 Antibody (C-term)
orb1427744-02 100 µL

CYP8B1 Antibody (C-term)

Sign In for Pricing
View Details
Sheep Thyroid adenoma associated protein (THADA) ELISA kit
GTR10405310 96 Well

Sheep Thyroid adenoma associated protein (THADA) ELISA kit

Sign In for Pricing
View Details
ZNF384 (NM_001039920) Human Tagged Lenti ORF Clone
RC208816L4 10 µg

ZNF384 (NM_001039920) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Recombinant MurineInterleukin-13 (rMuIL-13)
PR2010-01 1 mg

Recombinant MurineInterleukin-13 (rMuIL-13)

Sign In for Pricing
View Details
Recombinant MurineInterleukin-13 (rMuIL-13)
PR2010-02 2 µg

Recombinant MurineInterleukin-13 (rMuIL-13)

Sign In for Pricing
View Details