Cdh7 Peptide - N-terminal region
Cdh7 Peptide - N-terminal region
Product Specifications
Product Name Alternative
Cad7
UniProt
Q5DWV2
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Cdh7 Rabbit Polyclonal Antibody (orb579787) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001012755
Preservative
Lyophilized powder
AA Sequence
WNQFFVLEEYMGSDPLYVGKLHSDVDKGDGFIKYILSGEGASSIFIIDEN
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6257645-01 0.1 mL
EIF4EBP3 (4E BP3, 4E-BP3, 4EBP3, eIF4E Binding Protein 3, Eukaryotic initiation Factor 4E Binding Protein 3, Eukaryotic translation initiation Factor 4E Binding Protein 3) (PE)
Sign In for Pricing
View Details MBS6257645-02 5x 0.1 mL
EIF4EBP3 (4E BP3, 4E-BP3, 4EBP3, eIF4E Binding Protein 3, Eukaryotic initiation Factor 4E Binding Protein 3, Eukaryotic translation initiation Factor 4E Binding Protein 3) (PE)
Sign In for Pricing
View Details 