Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMEM30A Peptide - middle region

TMEM30A Peptide - middle region

Product Specifications

Product Name Alternative

C6orf67, CDC50A, FLJ10856

UniProt

Q9NV96

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TMEM30A Rabbit Polyclonal Antibody (orb325344) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IHC, WB

NCBI Accession Number

NP_060717

Preservative

Lyophilized powder

AA Sequence

FTLEKSFEGNVFMYYGLSNFYQNHRRYVKSRDDSQLNGDSSALLNPSKEC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GAPDH Mouse Monoclonal Antibody [Clone ID: 1A10A10]
AM11014PU-N 400 µL

GAPDH Mouse Monoclonal Antibody [Clone ID: 1A10A10]

Sign In for Pricing
View Details
ZAP70 (Chronic Lymphocytic Leukemia Marker) (ZAP70/2047), CF640R conjugate, 0.1mg/mL
BNC402047-100 1x 100 µL

ZAP70 (Chronic Lymphocytic Leukemia Marker) (ZAP70/2047), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CYP2C18 Rabbit Polyclonal Antibody
TA375284 100 µL

CYP2C18 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Myeloid tissue
CS630605 5x 5 µm

Frozen Tissue Sections, Myeloid tissue

Sign In for Pricing
View Details
PD-161570
TRC-P217490-5MG 5 mg

PD-161570

Sign In for Pricing
View Details
CD137 / 4-1BB / TNFRSF9 (4-1BB/3201), CF647 conjugate, 0.1mg/mL
BNC473201-500 1x 500 µL

CD137 / 4-1BB / TNFRSF9 (4-1BB/3201), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details