Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMEM30A Peptide - middle region

TMEM30A Peptide - middle region

Product Specifications

Product Name Alternative

C6orf67, CDC50A, FLJ10856

UniProt

Q9NV96

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TMEM30A Rabbit Polyclonal Antibody (orb325344) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IHC, WB

NCBI Accession Number

NP_060717

Preservative

Lyophilized powder

AA Sequence

FTLEKSFEGNVFMYYGLSNFYQNHRRYVKSRDDSQLNGDSSALLNPSKEC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tinopal RBS 200
TRC-T444095-10MG 10 mg

Tinopal RBS 200

Sign In for Pricing
View Details
Polystyrene A Sulfonic Acid
HA1251600430.25G 25 g

Polystyrene A Sulfonic Acid

Sign In for Pricing
View Details
Frozen Tissue Sections, Parathyroid gland
CS631040 5x 5 µm

Frozen Tissue Sections, Parathyroid gland

Sign In for Pricing
View Details
Recombinant Mouse Podoplanin/PDPN Protein (Fc Tag)
PKSM041291-01 10 µg

Recombinant Mouse Podoplanin/PDPN Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Mouse Podoplanin/PDPN Protein (Fc Tag)
PKSM041291-02 50 µg

Recombinant Mouse Podoplanin/PDPN Protein (Fc Tag)

Sign In for Pricing
View Details
RBM26 (N-term) Rabbit Polyclonal Antibody
AP53607PU-N 400 µL

RBM26 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details