Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hmgcs1 Peptide - C-terminal region

Hmgcs1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

B130032C06Rik, MGC36662, MGC98430

UniProt

Q8JZK9

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Hmgcs1 Rabbit Polyclonal Antibody (orb580449) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_666054

Preservative

Lyophilized powder

AA Sequence

LVRVDEKHRRTYARRPFTNDHSLDEGMGLVHSNTATEHIPSPAKKVPRLP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AHI1 Rabbit Polyclonal Antibody (Cy7)
orb1039033 100 µL

AHI1 Rabbit Polyclonal Antibody (Cy7)

Sign In for Pricing
View Details
HP AAV Vector (Mouse) (CMV)
23850104 1 µg

HP AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
Mouse IgM ELISA Kit
K3231088 96 Well

Mouse IgM ELISA Kit

Sign In for Pricing
View Details
hsa-miR-3934-3p miRNA Inhibitor
MBS8294736-01 10 nmol

hsa-miR-3934-3p miRNA Inhibitor

Sign In for Pricing
View Details
hsa-miR-3934-3p miRNA Inhibitor
MBS8294736-02 20 nmol

hsa-miR-3934-3p miRNA Inhibitor

Sign In for Pricing
View Details
hsa-miR-3934-3p miRNA Inhibitor
MBS8294736-03 5x 20 nmol

hsa-miR-3934-3p miRNA Inhibitor

Sign In for Pricing
View Details