Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hmgcs1 Peptide - C-terminal region

Hmgcs1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

B130032C06Rik, MGC36662, MGC98430

UniProt

Q8JZK9

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Hmgcs1 Rabbit Polyclonal Antibody (orb580449) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_666054

Preservative

Lyophilized powder

AA Sequence

LVRVDEKHRRTYARRPFTNDHSLDEGMGLVHSNTATEHIPSPAKKVPRLP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse TFPI Protein
RP01667-01 10 μg

Recombinant Mouse TFPI Protein

Sign In for Pricing
View Details
Recombinant Mouse TFPI Protein
RP01667-02 20 μg

Recombinant Mouse TFPI Protein

Sign In for Pricing
View Details
Recombinant Mouse TFPI Protein
RP01667-03 50 μg

Recombinant Mouse TFPI Protein

Sign In for Pricing
View Details
Recombinant Mouse TFPI Protein
RP01667-04 100 μg

Recombinant Mouse TFPI Protein

Sign In for Pricing
View Details
Recombinant Mouse TFPI Protein
RP01667-05 500 μg

Recombinant Mouse TFPI Protein

Sign In for Pricing
View Details
Recombinant Mouse TFPI Protein
RP01667-06 1000 μg

Recombinant Mouse TFPI Protein

Sign In for Pricing
View Details