Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Entpd7 Peptide - C-terminal region

Entpd7 Peptide - C-terminal region

Product Specifications

Product Name Alternative

1810012B13Rik, 1810020C02Rik, 2810003F23Rik, LALP1, Lysal2

UniProt

Q3TCT4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Entpd7 Rabbit Polyclonal Antibody (orb580755) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_444333

Preservative

Lyophilized powder

AA Sequence

GMAWPVLAQRFKNGLFSSHADEHRLKYQCFKSAWMYEVLHEGFHFPYDYP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Naphthol AS-D chloroacetate
sc-476892B 5 g

Naphthol AS-D chloroacetate

Sign In for Pricing
View Details
Mouse Monoclonal Azurocidin/CAP37/HBP Antibody (MM0099-7F31) [mFluor Violet 500 SE]
NBP2-12045MFV500 0.1 mL

Mouse Monoclonal Azurocidin/CAP37/HBP Antibody (MM0099-7F31) [mFluor Violet 500 SE]

Sign In for Pricing
View Details
Human IgA (alpha chain) Goat Polyclonal Antibody
AP00640PU-N 1 mg

Human IgA (alpha chain) Goat Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human WIPI-2 (C-His)
32-10376-50 50 µg

Recombinant Human WIPI-2 (C-His)

Sign In for Pricing
View Details
Chaf1a 3'UTR GFP Stable Cell Line
TU153800 1.0 mL

Chaf1a 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Phospho-ATF2 (Ser322) Polyclonal Antibody, AbBy Fluor™ 750 Conjugated
bs-5169R-BF750 100 µL

Phospho-ATF2 (Ser322) Polyclonal Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details