Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Entpd7 Peptide - C-terminal region

Entpd7 Peptide - C-terminal region

Product Specifications

Product Name Alternative

1810012B13Rik, 1810020C02Rik, 2810003F23Rik, LALP1, Lysal2

UniProt

Q3TCT4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Entpd7 Rabbit Polyclonal Antibody (orb580755) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_444333

Preservative

Lyophilized powder

AA Sequence

GMAWPVLAQRFKNGLFSSHADEHRLKYQCFKSAWMYEVLHEGFHFPYDYP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MLH1 Polyclonal Antibody, AbBy Fluor™ 350 Conjugated
bs-0836R-BF350 100 µL

MLH1 Polyclonal Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
44As3 Luciferase Reporter Cell Line
ABC-RC285H 1 Vial

44As3 Luciferase Reporter Cell Line

Sign In for Pricing
View Details
OSTA Rabbit Polyclonal Antibody (BF555)
orb2489057 100 µL

OSTA Rabbit Polyclonal Antibody (BF555)

Sign In for Pricing
View Details
Mouse Monoclonal Rhodopsin Antibody (B630) [Alexa Fluor 532]
NBP2-25160AF532 0.1 mL

Mouse Monoclonal Rhodopsin Antibody (B630) [Alexa Fluor 532]

Sign In for Pricing
View Details
LOC100129534 Recombinant Protein (Human)
RP017947 100 µg

LOC100129534 Recombinant Protein (Human)

Sign In for Pricing
View Details
Anti-Calumenin Rabbit Monoclonal Antibody
MA1572-.1 100 µL

Anti-Calumenin Rabbit Monoclonal Antibody

Sign In for Pricing
View Details