Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ankra2 Peptide - N-terminal region

Ankra2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

1110004M18Rik, AI450635, AU023827, Ankra, MGC90650

UniProt

Q99PE2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ankra2 Rabbit Polyclonal Antibody (orb581171) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_075961

Preservative

Lyophilized powder

AA Sequence

VAMGMKFILPNRFDMNVCSRFVKSLNEEDSKNIQDQVNSDLEVASVLFKA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Mitochondrial inner membrane protein (IMMT) , partial
MBS7074356 Inquire

Recombinant Human Mitochondrial inner membrane protein (IMMT) , partial

Sign In for Pricing
View Details
Indoleamine 2,3-Dioxygenase (IDO, Indoleamine-pyrrole 2,3-dioxygenase, INDO, Indole 2,3 dioxygenase, HGNC:6059) (MaxLight 750) discontinued
I7545-07C-ML750 100 µL

Indoleamine 2,3-Dioxygenase (IDO, Indoleamine-pyrrole 2,3-dioxygenase, INDO, Indole 2,3 dioxygenase, HGNC:6059) (MaxLight 750) discontinued

Sign In for Pricing
View Details
IL17 (IL17A) (NM_002190) Human Tagged ORF Clone Lentiviral Particle
RC218057L3V 200 µL

IL17 (IL17A) (NM_002190) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Lentiviral mouse Snx12 shRNA (UAS) - Lentiviral mouse Snx12 shRNA (UAS) (100)
GTR15180258 1 Vial

Lentiviral mouse Snx12 shRNA (UAS) - Lentiviral mouse Snx12 shRNA (UAS) (100)

Sign In for Pricing
View Details
5-Bromo-2- (difluoromethyl) -2H-indazole
PC1016941-01 250 mg

5-Bromo-2- (difluoromethyl) -2H-indazole

Sign In for Pricing
View Details
5-Bromo-2- (difluoromethyl) -2H-indazole
PC1016941-02 500 mg

5-Bromo-2- (difluoromethyl) -2H-indazole

Sign In for Pricing
View Details