Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Zfp69 Peptide - C-terminal region

Zfp69 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Gm1029, Krab2, Zfp63

UniProt

Q6NZQ1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Zfp69 Rabbit Polyclonal Antibody (orb325609) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001005788

Preservative

Lyophilized powder

AA Sequence

KAFRQRIHLSNHRTVHTGVKAYECNRCGKAYRHDSSFKKHQRHHTGEKPY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant SLC25A12 Monoclonal Antibody
AN301939L-01 50 µL

Recombinant SLC25A12 Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant SLC25A12 Monoclonal Antibody
AN301939L-02 100 µL

Recombinant SLC25A12 Monoclonal Antibody

Sign In for Pricing
View Details
C1QA / Complement C1q A-Chain (C1QA/2953), CF640R conjugate, 0.1mg/mL
BNC402953-500 1x 500 µL

C1QA / Complement C1q A-Chain (C1QA/2953), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
DNMT1 Rabbit Monoclonal Antibody
TA422920 100 µL

DNMT1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
DL-Threonic Acid Calcium
TRC-T405588-1MG 1 mg

DL-Threonic Acid Calcium

Sign In for Pricing
View Details
Human DYDC1 activation kit by CRISPRa
GA115451 1 Kit

Human DYDC1 activation kit by CRISPRa

Sign In for Pricing
View Details