Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Zfp69 Peptide - C-terminal region

Zfp69 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Gm1029, Krab2, Zfp63

UniProt

Q6NZQ1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Zfp69 Rabbit Polyclonal Antibody (orb325609) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001005788

Preservative

Lyophilized powder

AA Sequence

KAFRQRIHLSNHRTVHTGVKAYECNRCGKAYRHDSSFKKHQRHHTGEKPY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tyrosinase-Related Protein-1 (TYRP-1) (Melanoma Marker) (TYRP1/1986), CF594 conjugate, 0.1mg/mL
BNC941986-500 1x 500 µL

Tyrosinase-Related Protein-1 (TYRP-1) (Melanoma Marker) (TYRP1/1986), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
YM-08
SIH-122-10MG 10 mg

YM-08

Sign In for Pricing
View Details
GRP94 Antibody: APC
SPC-101D-APC 100 µg

GRP94 Antibody: APC

Sign In for Pricing
View Details
COL9A3 (NM_001853) Human Over-expression Lysate
LY419711 100 µg

COL9A3 (NM_001853) Human Over-expression Lysate

Sign In for Pricing
View Details
GPR116 Antibody
8G124-AAT 50 µg

GPR116 Antibody

Sign In for Pricing
View Details
CD63 (Late Endosomes Marker) (rMX-49.129.5), CF405S conjugate, 0.1mg/mL
BNC042562-500 1x 500 µL

CD63 (Late Endosomes Marker) (rMX-49.129.5), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details