Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dctn1 Peptide - C-terminal region

Dctn1 Peptide - C-terminal region

Product Specifications

UniProt

P28023

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Dctn1 Rabbit Polyclonal Antibody (orb330654) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_077044

Preservative

Lyophilized powder

AA Sequence

EANVRLSLLEKKLDSAAKDADERIEKVQTRLEETQTLLRKKEKEFEETMD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MIR4444-2 Protein Vector (Human) (pPB-N-His)
PV097371 500 ng

MIR4444-2 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Ivacaftor (hydrate)
HY-13017B 1 Each

Ivacaftor (hydrate)

Sign In for Pricing
View Details
Human METRN activation kit by CRISPRa
GA112306 1 Kit

Human METRN activation kit by CRISPRa

Sign In for Pricing
View Details
C10orf136 sgRNA CRISPR Lentivector (Human) (Target 2)
K0281803 1.0 µg DNA

C10orf136 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
(4'- (Trifluoromethyl) -[1,1'-biphenyl]-3-yl) boronic acid
PC109831-01 250 mg

(4'- (Trifluoromethyl) -[1,1'-biphenyl]-3-yl) boronic acid

Sign In for Pricing
View Details
(4'- (Trifluoromethyl) -[1,1'-biphenyl]-3-yl) boronic acid
PC109831-02 1 g

(4'- (Trifluoromethyl) -[1,1'-biphenyl]-3-yl) boronic acid

Sign In for Pricing
View Details