Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dctn1 Peptide - C-terminal region

Dctn1 Peptide - C-terminal region

Product Specifications

UniProt

P28023

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Dctn1 Rabbit Polyclonal Antibody (orb330654) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_077044

Preservative

Lyophilized powder

AA Sequence

EANVRLSLLEKKLDSAAKDADERIEKVQTRLEETQTLLRKKEKEFEETMD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rab 7L1 CRISPR Activation Plasmid (h2)
sc-403366-ACT-2 20 µg

Rab 7L1 CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details
PLP1 CRISPR Knock Out 293T Cell Line (Human)
37027141 1x 10^6 Cells / 1.0 mL

PLP1 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
Rabbit Anti-HECT E3 ubiquitin ligase antibody
SL15445R-01 50 µL

Rabbit Anti-HECT E3 ubiquitin ligase antibody

Sign In for Pricing
View Details
Rabbit Anti-HECT E3 ubiquitin ligase antibody
SL15445R-02 100 µL

Rabbit Anti-HECT E3 ubiquitin ligase antibody

Sign In for Pricing
View Details
Naphthol Green B For Microscopy
01782 00025 25 g

Naphthol Green B For Microscopy

Sign In for Pricing
View Details
Mouse Survivin ELISA kit
GTR10412400 96 Well

Mouse Survivin ELISA kit

Sign In for Pricing
View Details