Add1 Peptide - N-terminal region
Add1 Peptide - N-terminal region
Product Specifications
Product Name Alternative
MGC124621
UniProt
Q63028
Field of Research
Musculoskeletal & Connective Tissue Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Add1 Rabbit Polyclonal Antibody (orb581675) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_058686
Preservative
Lyophilized powder
AA Sequence
DTRAAVVTSPPPTTAPHKERYFDRVDENNPEYLRERNMAPDLRQDFNMME
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
DFP18-10LT 10 L
DMEM/F-12 With L-glutamine and 15 mM HEPES. No sodium bicarbonate.
Sign In for Pricing
View Details 
N2851-75 250 µg
NK1.1 Cell Surface Antigen (Killer Cell Lectin-like Receptor Subfamily B Member 1C, CD161 Antigen-like Family Member C, Lymphocyte Antigen 55c, Ly-55c, NKR-P1.9, NKR-P1C, Natural Killer Cell Surface Protein P1-40, NKR-P1 40, CD161c, Klrb1c, Ly55c, Nkrp1c)
Sign In for Pricing
View Details GTR15386194 1 Vial
Lentiviral human TMEM116 sgRNA gene knockout kit - Lentiviral human TMEM116 sgRNA gene knockout kit (100)
Sign In for Pricing
View Details