Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Add1 Peptide - N-terminal region

Add1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC124621

UniProt

Q63028

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Add1 Rabbit Polyclonal Antibody (orb581675) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_058686

Preservative

Lyophilized powder

AA Sequence

DTRAAVVTSPPPTTAPHKERYFDRVDENNPEYLRERNMAPDLRQDFNMME

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HYAL2 Blocking Peptide
MBS9621783-01 1 mg

HYAL2 Blocking Peptide

Sign In for Pricing
View Details
HYAL2 Blocking Peptide
MBS9621783-02 5x 1 mg

HYAL2 Blocking Peptide

Sign In for Pricing
View Details
Anti-UNC79 Antibody
CTA2518-01 30 µL

Anti-UNC79 Antibody

Sign In for Pricing
View Details
Anti-UNC79 Antibody
CTA2518-02 50 μL

Anti-UNC79 Antibody

Sign In for Pricing
View Details
Anti-UNC79 Antibody
CTA2518-03 100 µL

Anti-UNC79 Antibody

Sign In for Pricing
View Details
Anti-UNC79 Antibody
CTA2518-04 200 µL

Anti-UNC79 Antibody

Sign In for Pricing
View Details