Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cyb5d2 Peptide - C-terminal region

Cyb5d2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC94212

UniProt

Q6AY62

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Cyb5d2 Rabbit Polyclonal Antibody (orb581806) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001007672

Preservative

Lyophilized powder

AA Sequence

EWSSAKGSRLWCSQKSGGVHRDWIGVPRKLYKPGAKEPHCVCVRTTGPPS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

INTS1 (NM_001080453) Human Recombinant Protein
TP317456M 100 µg

INTS1 (NM_001080453) Human Recombinant Protein

Sign In for Pricing
View Details
C8orf80 (NUGGC) (NM_001010906) Human Over-expression Lysate
LC423221 20 µg

C8orf80 (NUGGC) (NM_001010906) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung: right upper lobe
CS713621 5x 5 µm

Tissue FFPE Sections, Lung: right upper lobe

Sign In for Pricing
View Details
AKR1B1 Human Gene Knockout Kit (CRISPR)
KN400504 1 Kit

AKR1B1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
LYN Antibody (Biotin)
KB-15261-01 50 μL

LYN Antibody (Biotin)

Sign In for Pricing
View Details
LYN Antibody (Biotin)
KB-15261-02 100 µL

LYN Antibody (Biotin)

Sign In for Pricing
View Details