Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cyb5d2 Peptide - C-terminal region

Cyb5d2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC94212

UniProt

Q6AY62

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Cyb5d2 Rabbit Polyclonal Antibody (orb581806) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001007672

Preservative

Lyophilized powder

AA Sequence

EWSSAKGSRLWCSQKSGGVHRDWIGVPRKLYKPGAKEPHCVCVRTTGPPS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1-(1-Chlorocyclopropyl)ethanone
TRC-C742520-500MG 500 mg

1-(1-Chlorocyclopropyl)ethanone

Sign In for Pricing
View Details
FOXA1 (Center) Rabbit Polyclonal Antibody
AP51701PU-N 400 µL

FOXA1 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Arginase 1 (Hepatocellular Carcinoma Marker) (ARG1/1126), CF594 conjugate, 0.1mg/mL
BNC941126-500 1x 500 µL

Arginase 1 (Hepatocellular Carcinoma Marker) (ARG1/1126), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MST1 Rabbit Polyclonal Antibody
HA500043 100 µL

MST1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Propyl 3,5-Dichloro-4-hydroxybenzoate
TRC-P839408-10MG 10 mg

Propyl 3,5-Dichloro-4-hydroxybenzoate

Sign In for Pricing
View Details
2010315L10Rik (BC025086) Mouse Tagged ORF Clone
MG201789 10 µg

2010315L10Rik (BC025086) Mouse Tagged ORF Clone

Sign In for Pricing
View Details