Asprv1 Peptide - middle region
Asprv1 Peptide - middle region
Product Specifications
Product Name Alternative
2300003P22Rik, AA986851, SASP, SASPase, Taps
UniProt
Q09PK2
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Asprv1 Rabbit Polyclonal Antibody (orb325821) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
AAI08358
Preservative
Lyophilized powder
AA Sequence
DVLQDHNAVLDFEHRTCTLKGKKFRLLPVGSSLEDEFDLELIEEEEESSA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15086063 1 Vial
Lentiviral human ESPL1 shRNA (UAS) - Lentiviral human ESPL1 shRNA (UAS, RFP) (25)
Sign In for Pricing
View Details 
GTR15375654 1 Vial
Lentiviral human PRMT5 sgRNA gene knockout kit - Lentiviral human PRMT5 sgRNA gene knockout kit (25)
Sign In for Pricing
View Details