Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Asprv1 Peptide - middle region

Asprv1 Peptide - middle region

Product Specifications

Product Name Alternative

2300003P22Rik, AA986851, SASP, SASPase, Taps

UniProt

Q09PK2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Asprv1 Rabbit Polyclonal Antibody (orb325821) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

AAI08358

Preservative

Lyophilized powder

AA Sequence

DVLQDHNAVLDFEHRTCTLKGKKFRLLPVGSSLEDEFDLELIEEEEESSA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Acetylcholinesterase (ACHE)
orb2658050-01 20 µg

Recombinant Human Acetylcholinesterase (ACHE)

Sign In for Pricing
View Details
Recombinant Human Acetylcholinesterase (ACHE)
orb2658050-02 100 µg

Recombinant Human Acetylcholinesterase (ACHE)

Sign In for Pricing
View Details
Recombinant Human Acetylcholinesterase (ACHE)
orb2658050-03 1 mg

Recombinant Human Acetylcholinesterase (ACHE)

Sign In for Pricing
View Details
ZADH2 AAV siRNA Pooled Vector
50669161 1.0 µg

ZADH2 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
IL-6 Polyclonal Antibody, AbBy Fluor™ 647 Conjugated
bs-4539R-BF647-TR 20 µL

IL-6 Polyclonal Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
SDHA Antibody
F52276-0.08ML 0.08 mL

SDHA Antibody

Sign In for Pricing
View Details