Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ldha Peptide - middle region

Ldha Peptide - middle region

Product Specifications

Product Name Alternative

Ldh1

UniProt

P04642

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ldha Rabbit Polyclonal Antibody (orb582144) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_058721

Preservative

Lyophilized powder

AA Sequence

LVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPQCKLLIVSNPV

More Discoveries

Explore Other Products

Browse additional items from our catalog

(±)-2-Heptanol
TRC-H281205-100G 100 g

(±)-2-Heptanol

Sign In for Pricing
View Details
RPL32P36 Adenovirus (Human)
41441051 1.0 mL

RPL32P36 Adenovirus (Human)

Sign In for Pricing
View Details
NEUROD4 Antibody
orb1327684 100 µg

NEUROD4 Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal FAM70B Antibody [mFluor Violet 610 SE]
NBP3-30755MFV610 0.1 mL

Rabbit Polyclonal FAM70B Antibody [mFluor Violet 610 SE]

Sign In for Pricing
View Details
N1- (2- (Ethoxy-d5) phenyl) -N2- (2-ethylphenyl) oxalamide-d5
HY-165697S 1 Each

N1- (2- (Ethoxy-d5) phenyl) -N2- (2-ethylphenyl) oxalamide-d5

Sign In for Pricing
View Details
Lentiviral mouse H2-M10.2 shRNA (UAS) - Lentiviral mouse H2-M10.2 shRNA (UAS, iRFP) (25)
GTR15275162 1 Vial

Lentiviral mouse H2-M10.2 shRNA (UAS) - Lentiviral mouse H2-M10.2 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details