Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ldha Peptide - middle region

Ldha Peptide - middle region

Product Specifications

Product Name Alternative

Ldh1

UniProt

P04642

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ldha Rabbit Polyclonal Antibody (orb582144) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_058721

Preservative

Lyophilized powder

AA Sequence

LVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPQCKLLIVSNPV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UBE2D (C-6) : m-IgGκ BP-HRP Bundle
sc-521554 1 Kit

UBE2D (C-6) : m-IgGκ BP-HRP Bundle

Sign In for Pricing
View Details
CTSV antibody
FNab01312 100 µg

CTSV antibody

Sign In for Pricing
View Details
Phospho-LKB1 (Ser428) Rabbit Polyclonal Antibody (PE-Cy5.5)
orb903660 100 µL

Phospho-LKB1 (Ser428) Rabbit Polyclonal Antibody (PE-Cy5.5)

Sign In for Pricing
View Details
SRPK1 (NM_003137) Human Tagged ORF Clone Lentiviral Particle
RC205315L2V 200 µL

SRPK1 (NM_003137) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
ANKRD33 Protein Vector (Mouse) (pPM-C-HA)
PV154568 500 ng

ANKRD33 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
PIRT Recombinant Protein Antigen
NBP1-90968PEP 0.1 mL

PIRT Recombinant Protein Antigen

Sign In for Pricing
View Details