Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Coil Peptide - C-terminal region

Coil Peptide - C-terminal region

Product Specifications

UniProt

Q923T0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Coil Rabbit Polyclonal Antibody (orb582154) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_059056

Preservative

Lyophilized powder

AA Sequence

PETQQVDIEVLSSLPALKEPGKFDLVYHNENGTEVVEYAVTQEKRITVFW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1- (23-Hydroxy-3,6,9,12,15,18,21-heptaoxatricosyl) -1H-pyrrole-2,5-dione
OR1070194-01 100 mg

1- (23-Hydroxy-3,6,9,12,15,18,21-heptaoxatricosyl) -1H-pyrrole-2,5-dione

Sign In for Pricing
View Details
1- (23-Hydroxy-3,6,9,12,15,18,21-heptaoxatricosyl) -1H-pyrrole-2,5-dione
OR1070194-02 250 mg

1- (23-Hydroxy-3,6,9,12,15,18,21-heptaoxatricosyl) -1H-pyrrole-2,5-dione

Sign In for Pricing
View Details
1- (23-Hydroxy-3,6,9,12,15,18,21-heptaoxatricosyl) -1H-pyrrole-2,5-dione
OR1070194-03 1 g

1- (23-Hydroxy-3,6,9,12,15,18,21-heptaoxatricosyl) -1H-pyrrole-2,5-dione

Sign In for Pricing
View Details
1- (23-Hydroxy-3,6,9,12,15,18,21-heptaoxatricosyl) -1H-pyrrole-2,5-dione
OR1070194-04 5 g

1- (23-Hydroxy-3,6,9,12,15,18,21-heptaoxatricosyl) -1H-pyrrole-2,5-dione

Sign In for Pricing
View Details
Mouse Jund (NM_010592) AAV Particle
MR205123A1V 250 µL

Mouse Jund (NM_010592) AAV Particle

Sign In for Pricing
View Details
ABHD3 Polyclonal Antibody
JOT-AP14040-01 20 µL

ABHD3 Polyclonal Antibody

Sign In for Pricing
View Details