Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Coil Peptide - C-terminal region

Coil Peptide - C-terminal region

Product Specifications

UniProt

Q923T0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Coil Rabbit Polyclonal Antibody (orb582154) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_059056

Preservative

Lyophilized powder

AA Sequence

PETQQVDIEVLSSLPALKEPGKFDLVYHNENGTEVVEYAVTQEKRITVFW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VAMP4 Antibody
42824 100 µL

VAMP4 Antibody

Sign In for Pricing
View Details
Gucy2c Mouse Pre-designed siRNA Set A
HY-RS16946 1 Set

Gucy2c Mouse Pre-designed siRNA Set A

Sign In for Pricing
View Details
PLVX-acGFP-N1-S1P4
PPL00268-3a 1 Each

PLVX-acGFP-N1-S1P4

Sign In for Pricing
View Details
N-Nitroso Acetylcysteine
CS-EO-02608 1 Each

N-Nitroso Acetylcysteine

Sign In for Pricing
View Details
Gzf1 (NM_028986) Mouse Tagged ORF Clone
MG210167 10 µg

Gzf1 (NM_028986) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
BNIP3 Rabbit Polyclonal Antibody (PE-Cy5)
orb878434 100 µL

BNIP3 Rabbit Polyclonal Antibody (PE-Cy5)

Sign In for Pricing
View Details