Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Spata6 Peptide - C-terminal region

Spata6 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Hash

UniProt

Q99MU5

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Spata6 Rabbit Polyclonal Antibody (orb582202) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_599219

Preservative

Lyophilized powder

AA Sequence

RVKDVLKSHQAHGRHLCEERDPEKEDELELKRSLLYRDSAYDSDPEYSSF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Emd sgRNA CRISPR Lentivector (Rat) (Target 1)
K6708602 1.0 µg DNA

Emd sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
NKX1-1 Rabbit Polyclonal Antibody (BF405)
orb2471156 100 µL

NKX1-1 Rabbit Polyclonal Antibody (BF405)

Sign In for Pricing
View Details
M6-9-423 Pre-sized Labels for Printers
174372 750 Roll (750 Label (s) x 1 Roll)

M6-9-423 Pre-sized Labels for Printers

Sign In for Pricing
View Details
V 356-200X200-B0455 V-shape & L-shape Signs
253612 1 Card (1 Panel (s) x 1 Pack)

V 356-200X200-B0455 V-shape & L-shape Signs

Sign In for Pricing
View Details
ITGA4 (Integrin alpha-4, CD49 Antigen-like Family Member D, Integrin alpha-IV, VLA-4 Subunit alpha, CD49d, MGC90518) (PE)
128625-PE 100 µL

ITGA4 (Integrin alpha-4, CD49 Antigen-like Family Member D, Integrin alpha-IV, VLA-4 Subunit alpha, CD49d, MGC90518) (PE)

Sign In for Pricing
View Details
Canine RNF4 ELISA Kit
ECR0073 96 Tests

Canine RNF4 ELISA Kit

Sign In for Pricing
View Details