Cdk5 Peptide - middle region
Cdk5 Peptide - middle region
Product Specifications
UniProt
Q03114
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Cdk5 Rabbit Polyclonal Antibody (orb582259) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_543161
Preservative
Lyophilized powder
AA Sequence
EIVKSLLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLADFGLARA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LV735316 1.0 µg DNA
MTND5P13 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
Sign In for Pricing
View Details 
039118-Biotin 200 µL
NR2C2, CT (NR2C2, TAK1, TR4, Nuclear receptor subfamily 2 group C member 2, Orphan nuclear receptor TAK1, Orphan nuclear receptor TR4, Testicular receptor 4) (Biotin) discontinued
Sign In for Pricing
View Details MBS1340902-01 0.02 mg (E-Coli)
Recombinant Mycoplasma pulmonis ATP synthase subunit beta 1 (atpD1)
Sign In for Pricing
View Details MBS1340902-02 0.02 mg (Yeast)
Recombinant Mycoplasma pulmonis ATP synthase subunit beta 1 (atpD1)
Sign In for Pricing
View Details MBS1340902-03 0.1 mg (E-Coli)
Recombinant Mycoplasma pulmonis ATP synthase subunit beta 1 (atpD1)
Sign In for Pricing
View Details