Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Sh3kbp1 Peptide - C-terminal region

Sh3kbp1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Seta

UniProt

Q6IRL5

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Sh3kbp1 Rabbit Polyclonal Antibody (orb582339) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_445812

Preservative

Lyophilized powder

AA Sequence

QSLTSSSLSSPDIFDSPSPEEDKEEHISLAHRGIDVSKKTSRTVTISQVS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IRAK4 Mouse mAb
E2220033 100 µg

IRAK4 Mouse mAb

Sign In for Pricing
View Details
HCV Core Ag,genotype 1, Recombinant
MBS319100-01 1 mg

HCV Core Ag,genotype 1, Recombinant

Sign In for Pricing
View Details
HCV Core Ag,genotype 1, Recombinant
MBS319100-02 5x 1 mg

HCV Core Ag,genotype 1, Recombinant

Sign In for Pricing
View Details
Epoxide Hydrolase 2, Cytoplasmic (EPHX2) Antibody
abx112320 100 µL

Epoxide Hydrolase 2, Cytoplasmic (EPHX2) Antibody

Sign In for Pricing
View Details
ENO3 (Enolase 3, 2-phospho-D-glycerate Hydro-lyase, beta-Enolase, Muscle-specific Enolase, MSE, Skeletal Muscle Enolase) (FITC)
126333-FITC 100 µL

ENO3 (Enolase 3, 2-phospho-D-glycerate Hydro-lyase, beta-Enolase, Muscle-specific Enolase, MSE, Skeletal Muscle Enolase) (FITC)

Sign In for Pricing
View Details
Rabbit Polyclonal Dengue Virus 2 Envelope Antibody [mFluor Violet 610 SE]
NBP3-06004MFV610 0.1 mL

Rabbit Polyclonal Dengue Virus 2 Envelope Antibody [mFluor Violet 610 SE]

Sign In for Pricing
View Details