Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Sh3kbp1 Peptide - C-terminal region

Sh3kbp1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Seta

UniProt

Q6IRL5

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Sh3kbp1 Rabbit Polyclonal Antibody (orb582339) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_445812

Preservative

Lyophilized powder

AA Sequence

QSLTSSSLSSPDIFDSPSPEEDKEEHISLAHRGIDVSKKTSRTVTISQVS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MALT1 Antibody
V7092SAF-100UG 100 µg

MALT1 Antibody

Sign In for Pricing
View Details
Phospho-HIST1H1C (T164) Antibody
MBS7106791-01 0.05 mL

Phospho-HIST1H1C (T164) Antibody

Sign In for Pricing
View Details
Phospho-HIST1H1C (T164) Antibody
MBS7106791-02 0.1 mL

Phospho-HIST1H1C (T164) Antibody

Sign In for Pricing
View Details
Phospho-HIST1H1C (T164) Antibody
MBS7106791-03 5x 0.1 mL

Phospho-HIST1H1C (T164) Antibody

Sign In for Pricing
View Details
Rabbit Tartrate Resistant Acid Phosphatase 5a ELISA Kit
MBS7231818-01 48 Well

Rabbit Tartrate Resistant Acid Phosphatase 5a ELISA Kit

Sign In for Pricing
View Details
Rabbit Tartrate Resistant Acid Phosphatase 5a ELISA Kit
MBS7231818-02 96 Well

Rabbit Tartrate Resistant Acid Phosphatase 5a ELISA Kit

Sign In for Pricing
View Details