Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Poc1a Peptide - C-terminal region

Poc1a Peptide - C-terminal region

Product Specifications

Product Name Alternative

RGD1565004

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Poc1a Rabbit Polyclonal Antibody (orb582680) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001102766

Preservative

Lyophilized powder

AA Sequence

SRTGEYFASGGSDEQVMVWKSNFDTVDYGDMKARRPPPQASSAGTPPEMD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BTBD4 CRISPR Activation Plasmid (h2)
sc-405127-ACT-2 20 µg

BTBD4 CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details
AR discontinued
533178-01 30ul

AR discontinued

Sign In for Pricing
View Details
AR discontinued
533178-02 100 µL

AR discontinued

Sign In for Pricing
View Details
SLC11A1 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
43868154 3x 1.0 µg DNA

SLC11A1 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
Pigeon Amine Oxidase [Flavin-Containing] A (MAOA) ELISA Kit
MBS9932655 Inquire

Pigeon Amine Oxidase [Flavin-Containing] A (MAOA) ELISA Kit

Sign In for Pricing
View Details
TRAF6 Polyclonal Antibody
A71407-050 50 µL

TRAF6 Polyclonal Antibody

Sign In for Pricing
View Details