Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Poc1a Peptide - C-terminal region

Poc1a Peptide - C-terminal region

Product Specifications

Product Name Alternative

RGD1565004

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Poc1a Rabbit Polyclonal Antibody (orb582680) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001102766

Preservative

Lyophilized powder

AA Sequence

SRTGEYFASGGSDEQVMVWKSNFDTVDYGDMKARRPPPQASSAGTPPEMD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Human Collagen Type II (ABT501) Mouse Monoclonal Antibody
MBS9511154-01 0.02 mL

Anti-Human Collagen Type II (ABT501) Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Anti-Human Collagen Type II (ABT501) Mouse Monoclonal Antibody
MBS9511154-02 0.05 mL

Anti-Human Collagen Type II (ABT501) Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Anti-Human Collagen Type II (ABT501) Mouse Monoclonal Antibody
MBS9511154-03 0.1 mL

Anti-Human Collagen Type II (ABT501) Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Anti-Human Collagen Type II (ABT501) Mouse Monoclonal Antibody
MBS9511154-04 0.2 mL

Anti-Human Collagen Type II (ABT501) Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Anti-Human Collagen Type II (ABT501) Mouse Monoclonal Antibody
MBS9511154-05 5x 0.2 mL

Anti-Human Collagen Type II (ABT501) Mouse Monoclonal Antibody

Sign In for Pricing
View Details
CDC2L5, NT (Cell division cycle 2-like protein kinase 5, Cholinesterase-related cell division controller, CDC2-related protein kinase 5) (Azide free) (HRP)
MBS6283878-01 0.2 mL

CDC2L5, NT (Cell division cycle 2-like protein kinase 5, Cholinesterase-related cell division controller, CDC2-related protein kinase 5) (Azide free) (HRP)

Sign In for Pricing
View Details