Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SAMHD1 Peptide - middle region

SAMHD1 Peptide - middle region

Product Specifications

Product Name Alternative

AGS5, DCIP, HDDC1, MOP-5, SBBI88, CHBL2

UniProt

Q9Y3Z3

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SAMHD1 Rabbit Polyclonal Antibody (orb330802) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_056289

Preservative

Lyophilized powder

AA Sequence

KGRPENKSFLYEIVSNKRNGIDVDKWDYFARDCHHLGIQNNFDYKRFIKF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLA2G4D (Cytosolic Phospholipase A2 delta, cPLA2-delta, Phospholipase A2 group IVD, PLA2G4D) (AP)
MBS6458175-01 0.1 mL

PLA2G4D (Cytosolic Phospholipase A2 delta, cPLA2-delta, Phospholipase A2 group IVD, PLA2G4D) (AP)

Sign In for Pricing
View Details
PLA2G4D (Cytosolic Phospholipase A2 delta, cPLA2-delta, Phospholipase A2 group IVD, PLA2G4D) (AP)
MBS6458175-02 5x 0.1 mL

PLA2G4D (Cytosolic Phospholipase A2 delta, cPLA2-delta, Phospholipase A2 group IVD, PLA2G4D) (AP)

Sign In for Pricing
View Details
P53 (Cellular Tumor Antigen p53, Tumor Suppressor p53, TP53, FLJ92943) discontinued
136309 50 µg

P53 (Cellular Tumor Antigen p53, Tumor Suppressor p53, TP53, FLJ92943) discontinued

Sign In for Pricing
View Details
Hepatitis B Surface Antigen, ad, ay (HBsAg) (AP) discontinued
H1909-27-AP 100 µL

Hepatitis B Surface Antigen, ad, ay (HBsAg) (AP) discontinued

Sign In for Pricing
View Details
Roquefortine C (Roquefortine)
MBS651469-01 0.5 mg

Roquefortine C (Roquefortine)

Sign In for Pricing
View Details
Roquefortine C (Roquefortine)
MBS651469-02 5x 0.5 mg

Roquefortine C (Roquefortine)

Sign In for Pricing
View Details