Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Sgms1 Peptide - middle region

Sgms1 Peptide - middle region

Product Specifications

Product Name Alternative

9530058O11Rik, AI841905, C80702, MGC30540, Mob, Sms1, Sor1, Tmem23

UniProt

Q8VCQ6

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Sgms1 Rabbit Polyclonal Antibody (orb582775) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_659041

Preservative

Lyophilized powder

AA Sequence

LTTVMISVVHERVPPKEVQPPLPDTFFDHFNRVQWAFSICEINGMILVGL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal IRF7 Antibody (3D9) [Alexa Fluor 647]
NBP1-04309AF647 0.1 mL

Mouse Monoclonal IRF7 Antibody (3D9) [Alexa Fluor 647]

Sign In for Pricing
View Details
Mmu-miR-7656-3p miRNA Inhibitor
CIM1768-01 10 nmol

Mmu-miR-7656-3p miRNA Inhibitor

Sign In for Pricing
View Details
Mmu-miR-7656-3p miRNA Inhibitor
CIM1768-02 20 nmol

Mmu-miR-7656-3p miRNA Inhibitor

Sign In for Pricing
View Details
Rat Angiopoietin Like Protein 3 (ANGPTL3) ELISA Kit
MBS2020761-01 24 Strip Well

Rat Angiopoietin Like Protein 3 (ANGPTL3) ELISA Kit

Sign In for Pricing
View Details
Rat Angiopoietin Like Protein 3 (ANGPTL3) ELISA Kit
MBS2020761-02 48 Well

Rat Angiopoietin Like Protein 3 (ANGPTL3) ELISA Kit

Sign In for Pricing
View Details
Rat Angiopoietin Like Protein 3 (ANGPTL3) ELISA Kit
MBS2020761-03 96 Well

Rat Angiopoietin Like Protein 3 (ANGPTL3) ELISA Kit

Sign In for Pricing
View Details