Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Sgms1 Peptide - middle region

Sgms1 Peptide - middle region

Product Specifications

Product Name Alternative

9530058O11Rik, AI841905, C80702, MGC30540, Mob, Sms1, Sor1, Tmem23

UniProt

Q8VCQ6

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Sgms1 Rabbit Polyclonal Antibody (orb582775) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_659041

Preservative

Lyophilized powder

AA Sequence

LTTVMISVVHERVPPKEVQPPLPDTFFDHFNRVQWAFSICEINGMILVGL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Replacement element only for 100D RJ50012 Combo mantle, 300W, 120V
100D RJ50012E 1 Each

Replacement element only for 100D RJ50012 Combo mantle, 300W, 120V

Sign In for Pricing
View Details
genesig Real-time PCR detection kit for E.coli_stx2A_V0
Z-Path-E-coli-stx2A-V0 150 Tests

genesig Real-time PCR detection kit for E.coli_stx2A_V0

Sign In for Pricing
View Details
Trypan Blue
ABC-BR0034 10 g

Trypan Blue

Sign In for Pricing
View Details
Human Papillomavirus 16 IgG (HPV16 IgG) ELISA Kit
abx051562 96 Tests

Human Papillomavirus 16 IgG (HPV16 IgG) ELISA Kit

Sign In for Pricing
View Details
Rabbit Polyclonal HAGHL Antibody
NBP2-87552 100 µL

Rabbit Polyclonal HAGHL Antibody

Sign In for Pricing
View Details
IGFBP2 Recombinant Antibody, AbBy Fluor™ 350 Conjugated
bsm-61716R-BF350-TR 20 µL

IGFBP2 Recombinant Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details