Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cpne2 Peptide - N-terminal region

Cpne2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

3322401K10Rik, MGC30751, MGC37787

UniProt

P59108

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Cpne2 Rabbit Polyclonal Antibody (orb582786) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_705727

Preservative

Lyophilized powder

AA Sequence

QCCVCKVELSVSGQNLLDRDVTSKSDPFCVLFIEDNGRWMEFDRTETAVN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DCTN2 Polyclonal Antibody, PE Conjugated
bs-7836R-PE 100 µL

DCTN2 Polyclonal Antibody, PE Conjugated

Sign In for Pricing
View Details
4-Benzylbenzaldehyde
OR70146-01 1 g

4-Benzylbenzaldehyde

Sign In for Pricing
View Details
4-Benzylbenzaldehyde
OR70146-02 5 g

4-Benzylbenzaldehyde

Sign In for Pricing
View Details
NR1H2 (Oxysterols Receptor LXR-beta, Liver X Receptor beta, Nuclear Receptor NER, Nuclear Receptor Subfamily 1 Group H Member 2, Ubiquitously-expressed Nuclear Receptor, LXRB, NER, UNR) (PE)
MBS6401482-01 0.1 mL

NR1H2 (Oxysterols Receptor LXR-beta, Liver X Receptor beta, Nuclear Receptor NER, Nuclear Receptor Subfamily 1 Group H Member 2, Ubiquitously-expressed Nuclear Receptor, LXRB, NER, UNR) (PE)

Sign In for Pricing
View Details
NR1H2 (Oxysterols Receptor LXR-beta, Liver X Receptor beta, Nuclear Receptor NER, Nuclear Receptor Subfamily 1 Group H Member 2, Ubiquitously-expressed Nuclear Receptor, LXRB, NER, UNR) (PE)
MBS6401482-02 5x 0.1 mL

NR1H2 (Oxysterols Receptor LXR-beta, Liver X Receptor beta, Nuclear Receptor NER, Nuclear Receptor Subfamily 1 Group H Member 2, Ubiquitously-expressed Nuclear Receptor, LXRB, NER, UNR) (PE)

Sign In for Pricing
View Details
Heat shock protein (M. leprae/M. tuberculosis HSP65; 417-429) P38 peptide (AGGGVTLLQAAPALD, MW:1353.5)
HSP652-P 1 mg

Heat shock protein (M. leprae/M. tuberculosis HSP65; 417-429) P38 peptide (AGGGVTLLQAAPALD, MW:1353.5)

Sign In for Pricing
View Details