Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CABCOCO1 Peptide - C-terminal region

CABCOCO1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

RGD1306739

UniProt

D3ZD36

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CABCOCO1 Rabbit Polyclonal Antibody (orb326015) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001128048

Preservative

Lyophilized powder

AA Sequence

PLGGFTIDDVKLALARVTDEVLISIQNEINEKLQVQEESFNARIEKLKKA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Phospho-PLC-gamma 1 (Y783) MAb (Clone 764518)
MAB7454 100 µg

Human Phospho-PLC-gamma 1 (Y783) MAb (Clone 764518)

Sign In for Pricing
View Details
Anti-CCL2 Antibody Picoband® Fluoro488 Conjugated
A00056-4-Fluoro488 100 µg/Vial

Anti-CCL2 Antibody Picoband® Fluoro488 Conjugated

Sign In for Pricing
View Details
Lentiviral human GSG1 shRNA (UAS) - Lentiviral human GSG1 shRNA (UAS) plasmid
GTR15342634 1 Vial

Lentiviral human GSG1 shRNA (UAS) - Lentiviral human GSG1 shRNA (UAS) plasmid

Sign In for Pricing
View Details
NCR2 Antibody
CSB-PA551201-01 50 μL

NCR2 Antibody

Sign In for Pricing
View Details
NCR2 Antibody
CSB-PA551201-02 100 µL

NCR2 Antibody

Sign In for Pricing
View Details
PPP2CBP1 Protein Vector (Human) (pPM-C-His)
PV112897 500 ng

PPP2CBP1 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details