Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CABCOCO1 Peptide - C-terminal region

CABCOCO1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

RGD1306739

UniProt

D3ZD36

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CABCOCO1 Rabbit Polyclonal Antibody (orb326015) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001128048

Preservative

Lyophilized powder

AA Sequence

PLGGFTIDDVKLALARVTDEVLISIQNEINEKLQVQEESFNARIEKLKKA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

COQ6 CytoSection
TS417898P5 25 Slides

COQ6 CytoSection

Sign In for Pricing
View Details
Glutathione (MaxLight 405)
MBS6244886-01 0.1 mL

Glutathione (MaxLight 405)

Sign In for Pricing
View Details
Glutathione (MaxLight 405)
MBS6244886-02 5x 0.1 mL

Glutathione (MaxLight 405)

Sign In for Pricing
View Details
JMJD4 Knockout MES-OV Polyclonal Cells
ARG24689 1 Million

JMJD4 Knockout MES-OV Polyclonal Cells

Sign In for Pricing
View Details
Mangiferin discontinued
371673 5 mg

Mangiferin discontinued

Sign In for Pricing
View Details
Porcine PIICP (Procollagen Type II C-Terminal Propeptide) ELISA Kit
EP0343 96 Tests

Porcine PIICP (Procollagen Type II C-Terminal Propeptide) ELISA Kit

Sign In for Pricing
View Details