Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UCHL1 Peptide - middle region

UCHL1 Peptide - middle region

Product Specifications

Product Name Alternative

PARK5, PGP9.5, PGP95, Uch-L1

UniProt

P09936

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with UCHL1 Rabbit Polyclonal Antibody (orb331009) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004172

Preservative

Lyophilized powder

AA Sequence

AVANNQDKLGFEDGSVLKQFLSETEKMSPEDRAKCFEKNEAIQAAHDAVA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

60S ribosomal protein L8 (RPL8) Human ELISA Kit
B1476 96 Tests

60S ribosomal protein L8 (RPL8) Human ELISA Kit

Sign In for Pricing
View Details
Recombinant Staphylococcus Aureus lytS Protein (aa 1-584) (strain MW2)
VAng-Cr5893-inquire Inquire

Recombinant Staphylococcus Aureus lytS Protein (aa 1-584) (strain MW2)

Sign In for Pricing
View Details
PDIA2 Double Nickase Plasmid (h2)
sc-413019-NIC-2 20 µg

PDIA2 Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
Anti-Phospho-STK3 (S316) Antibody
P02224 100 µL

Anti-Phospho-STK3 (S316) Antibody

Sign In for Pricing
View Details
KCNMA1 Protein Vector (Mouse) (pPM-C-HA)
PV193664 500 ng

KCNMA1 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
RsmB Antibody
orb828163 2 mg

RsmB Antibody

Sign In for Pricing
View Details