Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UCHL1 Peptide - middle region

UCHL1 Peptide - middle region

Product Specifications

Product Name Alternative

PARK5, PGP9.5, PGP95, Uch-L1

UniProt

P09936

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with UCHL1 Rabbit Polyclonal Antibody (orb331009) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004172

Preservative

Lyophilized powder

AA Sequence

AVANNQDKLGFEDGSVLKQFLSETEKMSPEDRAKCFEKNEAIQAAHDAVA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NUDT14 (NM_177533) Human Untagged Clone
SC126626 10 µg

NUDT14 (NM_177533) Human Untagged Clone

Sign In for Pricing
View Details
C1QA Recombinant Rabbit mAb
orb2324303-01 25 µL

C1QA Recombinant Rabbit mAb

Sign In for Pricing
View Details
C1QA Recombinant Rabbit mAb
orb2324303-02 50 µL

C1QA Recombinant Rabbit mAb

Sign In for Pricing
View Details
C1QA Recombinant Rabbit mAb
orb2324303-03 100 µL

C1QA Recombinant Rabbit mAb

Sign In for Pricing
View Details
Human BCL2 Like 10 protein
orb623394-01 5 µg

Human BCL2 Like 10 protein

Sign In for Pricing
View Details
Human BCL2 Like 10 protein
orb623394-02 20 µg

Human BCL2 Like 10 protein

Sign In for Pricing
View Details