Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATG10 Peptide - C-terminal region

ATG10 Peptide - C-terminal region

Product Specifications

Product Name Alternative

APG10, APG10L, DKFZp586I0418, FLJ13954, pp12616

UniProt

Q9H0Y0

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ATG10 Rabbit Polyclonal Antibody (orb584210) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001124500

Preservative

Lyophilized powder

AA Sequence

FFVLHPCKTNEFMTPVLKNSQKINKNVNYITSWLSIVGPVVGLNLPLSYA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATP5F1P7 Adenovirus (Human)
12722051 1.0 mL

ATP5F1P7 Adenovirus (Human)

Sign In for Pricing
View Details
CU-T12-9 5mg
A24317-5 5 mg

CU-T12-9 5mg

Sign In for Pricing
View Details
DR1, ID (DR1, Protein Dr1, Down-regulator of transcription 1, Negative cofactor 2-beta, TATA-binding protein-associated phosphoprotein) (Azide free) (HRP) discontinued
034794-HRP 200 µL

DR1, ID (DR1, Protein Dr1, Down-regulator of transcription 1, Negative cofactor 2-beta, TATA-binding protein-associated phosphoprotein) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
CD49b antibody
10R-CD49BB 0.1 mg

CD49b antibody

Sign In for Pricing
View Details
Monkey Myosin Heavy Chain 8, Skeletal Muscle, Perinatal ELISA Kit
MBS068081-01 48 Well

Monkey Myosin Heavy Chain 8, Skeletal Muscle, Perinatal ELISA Kit

Sign In for Pricing
View Details
Monkey Myosin Heavy Chain 8, Skeletal Muscle, Perinatal ELISA Kit
MBS068081-02 96 Well

Monkey Myosin Heavy Chain 8, Skeletal Muscle, Perinatal ELISA Kit

Sign In for Pricing
View Details