Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHRM1 Peptide - C-terminal region

CHRM1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

HM1, M1, M1R, MGC30125

UniProt

P11229

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CHRM1 Rabbit Polyclonal Antibody (orb584874) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000729

Preservative

Lyophilized powder

AA Sequence

VKRPTKKGRDRAGKGQKPRGKEQLAKRKTFSLVKEKKAARTLSAILLAFI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LRRC70 Antibody - C-terminal region
OAAB14494-400UL 400 µL

LRRC70 Antibody - C-terminal region

Sign In for Pricing
View Details
Recombinant Mouse TECTB Protein, His (Fc)-Avi-tagged
TECTB-9121M 50 µg

Recombinant Mouse TECTB Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
PCGF1 Antibody (FITC)
orb418429-01 50 µg

PCGF1 Antibody (FITC)

Sign In for Pricing
View Details
PCGF1 Antibody (FITC)
orb418429-02 100 µg

PCGF1 Antibody (FITC)

Sign In for Pricing
View Details
CCDC27 Mouse Monoclonal Antibody [Clone ID: OTI1F8]
TA811190S 30 µL

CCDC27 Mouse Monoclonal Antibody [Clone ID: OTI1F8]

Sign In for Pricing
View Details
HSPA1A Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV689078 1.0 µg DNA

HSPA1A Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details