Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHRM1 Peptide - C-terminal region

CHRM1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

HM1, M1, M1R, MGC30125

UniProt

P11229

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CHRM1 Rabbit Polyclonal Antibody (orb584874) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000729

Preservative

Lyophilized powder

AA Sequence

VKRPTKKGRDRAGKGQKPRGKEQLAKRKTFSLVKEKKAARTLSAILLAFI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse C-C motif chemokine 5 protein (Ccl5), Active Protein
RPC29041-01 Inquire

Recombinant Mouse C-C motif chemokine 5 protein (Ccl5), Active Protein

Sign In for Pricing
View Details
Recombinant Mouse C-C motif chemokine 5 protein (Ccl5), Active Protein
RPC29041-02 100 µg

Recombinant Mouse C-C motif chemokine 5 protein (Ccl5), Active Protein

Sign In for Pricing
View Details
Mouse Monoclonal CDK2 Antibody (C15.2) [HRP]
NB100-2686H 0.1 mL

Mouse Monoclonal CDK2 Antibody (C15.2) [HRP]

Sign In for Pricing
View Details
Anti-Fruit fly Neto Antibody, Dylight550 Conjugate
DZ41619-Dylight550 200 µL

Anti-Fruit fly Neto Antibody, Dylight550 Conjugate

Sign In for Pricing
View Details
BRAF antibody
70R-51468 100 ul

BRAF antibody

Sign In for Pricing
View Details
HLA-DPA1 Knockout HAP1 Polyclonal Cells
ARG22537 1 Million

HLA-DPA1 Knockout HAP1 Polyclonal Cells

Sign In for Pricing
View Details