Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD83 Peptide - C-terminal region

CD83 Peptide - C-terminal region

Product Specifications

Product Name Alternative

BL11, HB15

UniProt

Q01151

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CD83 Rabbit Polyclonal Antibody (orb584903) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004224

Preservative

Lyophilized powder

AA Sequence

GTYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRAEIVLLLALV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MGC4172 Rabbit Polyclonal Antibody (FITC)
orb2112555 100 µL

MGC4172 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Cyclo(-Ala-Gln)
G-4770.0250 250.0mg

Cyclo(-Ala-Gln)

Sign In for Pricing
View Details
KCNJ5 (NM_000890) Human Over-expression Lysate
LC424464 20 µg

KCNJ5 (NM_000890) Human Over-expression Lysate

Sign In for Pricing
View Details
Sumo2 Mouse shRNA Plasmid (Locus ID 170930)
TL506101 1 Kit

Sumo2 Mouse shRNA Plasmid (Locus ID 170930)

Sign In for Pricing
View Details
Cdk1 (NM_007659) Mouse Tagged ORF Clone Lentiviral Particle
MR204122L3V 200 µL

Cdk1 (NM_007659) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
2-Furoyl-LIGRLO-amide (TFA)
HY-P1314A 1 Each

2-Furoyl-LIGRLO-amide (TFA)

Sign In for Pricing
View Details