Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD83 Peptide - C-terminal region

CD83 Peptide - C-terminal region

Product Specifications

Product Name Alternative

BL11, HB15

UniProt

Q01151

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CD83 Rabbit Polyclonal Antibody (orb584903) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004224

Preservative

Lyophilized powder

AA Sequence

GTYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRAEIVLLLALV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Low Sample Volume ELISA Kit for Kisspeptin 1 (KISS1)
TRV-0040184-01 24 Tests

Low Sample Volume ELISA Kit for Kisspeptin 1 (KISS1)

Sign In for Pricing
View Details
Low Sample Volume ELISA Kit for Kisspeptin 1 (KISS1)
TRV-0040184-02 48 Tests

Low Sample Volume ELISA Kit for Kisspeptin 1 (KISS1)

Sign In for Pricing
View Details
Low Sample Volume ELISA Kit for Kisspeptin 1 (KISS1)
TRV-0040184-03 96 Tests

Low Sample Volume ELISA Kit for Kisspeptin 1 (KISS1)

Sign In for Pricing
View Details
Low Sample Volume ELISA Kit for Kisspeptin 1 (KISS1)
TRV-0040184-04 5x 96 Tests

Low Sample Volume ELISA Kit for Kisspeptin 1 (KISS1)

Sign In for Pricing
View Details
Low Sample Volume ELISA Kit for Kisspeptin 1 (KISS1)
TRV-0040184-05 10x 96 Tests

Low Sample Volume ELISA Kit for Kisspeptin 1 (KISS1)

Sign In for Pricing
View Details
INPP5E Antibody, HRP conjugated
A68451-50UG 50 µg

INPP5E Antibody, HRP conjugated

Sign In for Pricing
View Details